PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa05g087630.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HD-ZIP
Protein Properties Length: 301aa    MW: 33826.6 Da    PI: 5.207
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa05g087630.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox566.9e-1886139356
                     --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     k+++++ eq+++Le+ Fe  +++  e++ +LA+ lgL+ rq+ +WFqNrRa++k
  Csa05g087630.1  86 KKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWK 139
                     456899***********************************************9 PP

2HD-ZIP_I/II131.92.3e-4285176192
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                     ekkrrl+ eqvk+LE++Fe  +kLeperK++lar+Lglqprq+a+WFqnrRAR+ktkqlEkdy++Lkr++dalk+en+ L++++++L++e++
  Csa05g087630.1  85 EKKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWKTKQLEKDYDTLKRQFDALKSENDLLQTHNQKLQAEIM 176
                     69**************************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.5E-1975143IPR009057Homeodomain-like
PROSITE profilePS5007117.21681141IPR001356Homeobox domain
SMARTSM003891.8E-1784145IPR001356Homeobox domain
PfamPF000463.1E-1586139IPR001356Homeobox domain
CDDcd000862.90E-1686142No hitNo description
Gene3DG3DSA:1.10.10.606.1E-1988148IPR009057Homeodomain-like
PRINTSPR000311.2E-5112121IPR000047Helix-turn-helix motif
PROSITE patternPS000270116139IPR017970Homeobox, conserved site
PRINTSPR000311.2E-5121137IPR000047Helix-turn-helix motif
CDDcd146860.00961134175No hitNo description
PfamPF021832.2E-16141182IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MSCNNGMSFF PSNFMIQTSY EDDHPHQSPS LAPLLPSCSL PQDLHGFASF LGKRSPMEGC  60
CDLEPGNNMN GGEDDYSDDG SQMGEKKRRL NMEQVKTLEK NFELGNKLEP ERKMQLARAL  120
GLQPRQIAIW FQNRRARWKT KQLEKDYDTL KRQFDALKSE NDLLQTHNQK LQAEIMGLKS  180
REQTESINLN KDTEGSCSNR SDNSSDNLRL DISTAPPPSI ESTLTGGQPP PPPQTLGRHF  240
FPPSSPATGT TTNTTTTMQF FQNSSSGQSM VKEENSISNM FCAMDDHSGF WPWLDQQQYN  300
*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1133141RRARWKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF2080440.0AF208044.1 Arabidopsis thaliana homeodomain leucine-zipper protein ATHB13 mRNA, complete cds.
GenBankAY0575720.0AY057572.1 Arabidopsis thaliana At1g69780/T6C23_2 mRNA, complete cds.
GenBankAY1336450.0AY133645.1 Arabidopsis thaliana At1g69780/T6C23_2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010512033.10.0PREDICTED: homeobox-leucine zipper protein ATHB-13
SwissprotQ8LC030.0ATB13_ARATH; Homeobox-leucine zipper protein ATHB-13
TrEMBLE4MXR40.0E4MXR4_EUTHA; mRNA, clone: RTFL01-34-O11
TrEMBLV4KEK50.0V4KEK5_EUTSA; Uncharacterized protein
STRINGAT1G69780.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26332770
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.11e-163HD-ZIP family protein